AibGenesis™ Mouse Anti-PRLHR Antibody (CBMOAB-55342FYA)


Cat: CBMOAB-55342FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55342FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Pig (Sus scrofa) WB, ELISA MO55342FYA 100 µg
MO-AB-18514R Monoclonal Cattle (Bos taurus) WB, ELISA MO18514R 100 µg
MO-AB-28580R Monoclonal Pig (Sus scrofa) WB, ELISA MO28580R 100 µg
MO-AB-62310W Monoclonal Marmoset WB, ELISA MO62310W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Pig (Sus scrofa)
CloneMO55342FYA
SpecificityThis antibody binds to Rhesus PRLHR.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PRLHR Antibody is a mouse antibody against PRLHR. It can be used for PRLHR detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPRLHR
UniProt IDF7GNK6
Protein RefseqThe length of the protein is 319 amino acids long.
The sequence is show below: XLQLVHQLKGLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCAACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAMHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWHRARRRRTFCLLVVVVVVFAVCWLPLHVFNLLRDLDPRAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLLAWPRKIAPHGQNMTVSVVI.
For Research Use Only | Not For Clinical Use.
Online Inquiry