AibGenesis™ Mouse Anti-PROCA1 Antibody (CBMOAB-55366FYA)


Cat: CBMOAB-55366FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55366FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio) WB, ELISA MO55366FYA 100 µg
CBMOAB-94053FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO94053FYA 100 µg
MO-AB-18582R Monoclonal Cattle (Bos taurus) WB, ELISA MO18582R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio)
CloneMO55366FYA
SpecificityThis antibody binds to Rhesus PROCA1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PROCA1 Antibody is a mouse antibody against PROCA1. It can be used for PROCA1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPROCA1
UniProt IDF6UM40
Protein RefseqThe length of the protein is 113 amino acids long.
The sequence is show below: GALALPCFLLFPPSFPSFFPSFSFPPFPPYSFRLLWCPPPVPRGRGELLGPAGQGGFCTDEHNLCKQVTQGREDICWLVWRPALMCLPSLKVTARSLTSAAGHKQCTGHIIYP.
For Research Use Only | Not For Clinical Use.
Online Inquiry