AibGenesis™ Mouse Anti-PROSC Antibody (CBMOAB-55388FYA)


Cat: CBMOAB-55388FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55388FYA Monoclonal Rhesus (Macaca mulatta), Hamsters (Cricetinae), O. mykiss (Oncorhynchus mykiss), Zebrafish (Danio rerio) WB, ELISA MO55388FYA 100 µg
CBMOAB-94082FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO94082FYA 100 µg
MO-AB-12835Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO12835Y 100 µg
MO-AB-43384W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43384W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Hamsters (Cricetinae), O. mykiss (Oncorhynchus mykiss), Zebrafish (Danio rerio)
CloneMO55388FYA
SpecificityThis antibody binds to Rhesus PROSC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPyridoxal 5''-phosphate (PLP)-binding protein, which may be involved in intracellular homeostatic regulation of pyridoxal 5''-phosphate (PLP), the active form of vitamin B6. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus PROSC Antibody is a mouse antibody against PROSC. It can be used for PROSC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPROSC
UniProt IDF6R5U2
Protein RefseqThe length of the protein is 275 amino acids long.
The sequence is show below: MWRAGSMSAELGVGCALRAVNERVQQAVARRPRDLPAIQPRLVAVSKTKPADMVIEAYGHGQRTFGENYVQELLEKASNPKILSLCPEIKWHFIGHLQKQNVNKLMAVPNLFMLETVDSLKLADKVNSSWQKKGSPERLKVMVQINTSGEESKHGLPPSETIAVVEHINAKCPSLEFVGLMTIGSFGHDLSQGPNPDFQLLLSLRKELCKKLNIPADQVELSMGMSVDFQHAIEVGSTNVRIGSIIFGERDYSKKPTPDKCAADVKAPREVAQEH.
For Research Use Only | Not For Clinical Use.
Online Inquiry