AibGenesis™ Mouse Anti-PRR15L Antibody (MO-AB-18644R)


Cat: MO-AB-18644R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-18644R Monoclonal Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO18644R 100 µg
MO-AB-28103H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28103C 100 µg
MO-AB-62376W Monoclonal Marmoset WB, ELISA MO62376W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO18644R
SpecificityThis antibody binds to Cattle PRR15L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against PRR15L. It can be used for PRR15L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProline-rich protein 15-like protein; Protein ATAD4; PRR15L; ATAD4
UniProt IDQ3T183
Protein RefseqThe length of the protein is 100 amino acids long.
The sequence is show below: MTEVGWWKLTFLRKKKSTPKVLYEIPDTYTQSEGGAEPPRPDSGNPNSNFNTRLEKIVDKNTKGKHVKVSNSGRFKEKKKVRASLAENPNLFDDREGKGQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry