AibGenesis™ Mouse Anti-PRR5L Antibody (CBMOAB-55457FYA)


Cat: CBMOAB-55457FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55457FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO55457FYA 100 µg
MO-AB-05376W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05376W 100 µg
MO-AB-18651R Monoclonal Cattle (Bos taurus) WB, ELISA MO18651R 100 µg
MO-AB-25628W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25628W 100 µg
MO-AB-62383W Monoclonal Marmoset WB, ELISA MO62383W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO55457FYA
SpecificityThis antibody binds to Rhesus PRR5L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PRR5L Antibody is a mouse antibody against PRR5L. It can be used for PRR5L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPRR5L
UniProt IDF7HMD9
Protein RefseqThe length of the protein is 368 amino acids long.
The sequence is show below: MTRGFAPTLPGEFHKMGSFRRPRPRFMSSPVLSDLPRFQATRQALQLSSSSAWNSVQTAVINVFKGGGLQSNELYALNENIRRLLKSELGSFITDYFQNQLLAKGLFFVEEKIKLCEGENRIEVLAEVWDHFFTETLPTLQAIFYPVQGQELTIRQISLLGFRDLVLLKVKLGDLLLLAQSKLPSSIVQMLLILQSVHEPTGPSESYLQLEELVKQVVSPFLGISGDRSFSGPTYTLARRHSRVRPKVTVLNYASPITAVSRPLNEMVLTPLTEQEGEAYLEKCGSVRRHTVANAHSDIQLLAMATMMHSGLGEEASSEDKCLLLPPSFPPPHRQCSSEPNITDSPDGLEEGAGGSQEGSELNCASLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry