AibGenesis™ Mouse Anti-PRXL2B Antibody (MO-AB-18676R)


Cat: MO-AB-18676R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-18676R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO18676R 100 µg
MO-AB-24433W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24433W 100 µg
MO-AB-28125H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28125C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO18676R
SpecificityThis antibody binds to Cattle PRXL2B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against PRXL2B. It can be used for PRXL2B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProstamide/prostaglandin F synthase; Prostamide/PG F synthase; Prostamide/PGF synthase; EC 1.11.1.20; FAM213B
UniProt IDQ58CY6
Protein RefseqThe length of the protein is 201 amino acids long.
The sequence is show below: MSTVDLARVGACVLKHAVTGEAVELRNLWQEQACVVAGLRRFGCMVCRWIARDLSNLKGLLDQHGVRLVGVGPEALGLQEFLDGGYFAGELYLDESKQFYKELGFKRYNSLSILPAALGKPVREVAAKAKAVGIQGNLSGDLLQSGGLLVVAKGGDKVLLHFVQKSPGDYAPLESILQALGISAEVGPSELPQCDEEACSR.
For Research Use Only | Not For Clinical Use.
Online Inquiry