AibGenesis™ Mouse Anti-PSAJ Antibody (CBMOAB-39395FYC)
Cat: CBMOAB-39395FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-39395FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris) | WB, ELISA | MO39395FC | 100 µg | ||
| CBMOAB-88919FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO88919FYB | 100 µg | ||
| MO-AB-00506W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00506W | 100 µg | ||
| MO-AB-30485H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30485C | 100 µg | ||
| MO-AB-39429W | Monoclonal | Grape (Vitis vinifera) | WB, ELISA | MO39429W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris) |
| Clone | MO39395FC |
| Specificity | This antibody binds to Arabidopsis PSAJ. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Chloroplast; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Arabidopsis PSAJ Antibody is a mouse antibody against PSAJ. It can be used for PSAJ detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Photosystem I reaction center subunit IX; PSI-J; psaJ; AtCg00630 |
| UniProt ID | P56769 |
| Protein Refseq | The length of the protein is 44 amino acids long. The sequence is show below: MRDLKTYLSVAPVLSTLWFGSLAGLLIEINRLFPDALTFPFFSF. |
For Research Use Only | Not For Clinical Use.
Online Inquiry