AibGenesis™ Mouse Anti-PSBE Antibody (CBMOAB-39415FYC)


Cat: CBMOAB-39415FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
  • Reference
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39415FYC Monoclonal WB, ELISA MO39415FC 100 µg
Inquiry
CBMOAB-88931FYB Monoclonal Rice (Oryza) WB, ELISA MO88931FYB 100 µg
Inquiry
MO-AB-00511W Monoclonal Barrel medic (Medicago truncatula) WB, ELISA MO00511W 100 µg
Inquiry
MO-AB-27984W Monoclonal Cottonwood (Populus deltoids) WB, ELISA MO27984W 100 µg
Inquiry
MO-AB-36420W Monoclonal French-bean WB, ELISA MO36420W 100 µg
Inquiry
MO-AB-30489H Monoclonal Sugar beet (Beta vulgaris) WB, ELISA MO30489C 100 µg
Inquiry
MO-AB-01907L Monoclonal Bromus (Bromus vulgaris) WB, ELISA MO01907L 100 µg
Inquiry
MO-DKB-0423RA Polyclonal WB 50 µL
Inquiry
MO-DKB-01731W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), A. thaliana (Arabidopsis thaliana); H. vulgare (Hordeum vulgare); N. tabacum (Nicotiana tabacum); Rice (Oryza); Spinach (Spinacia oleracea); T. aestivum (Triticum aestivum), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cottonwood (Populus deltoids), French-bean, Rice (Oryza), Sugar beet (Beta vulgaris)
CloneMO39415FC
SpecificityThis antibody binds to Arabidopsis PSBE.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis b-type cytochrome is tightly associated with the reaction center of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from HO, generating O and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Arabidopsis PSBE Antibody is a mouse antibody against PSBE. It can be used for PSBE detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome b559 subunit alpha; PSII reaction center subunit V; psbE; AtCg00580
UniProt IDP56779
Protein RefseqThe length of the protein is 83 amino acids long. The sequence is show below: MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQGIPLITGRFDSLEQLDEFSRSF.

Reference

Reference1. Méteignier, L. V., Ghandour, R., Meierhoff, K., Zimmerman, A., Chicher, J., Baumberger, N., ... & Hammani, K. (2020). The Arabidopsis mTERF-repeat MDA1 protein plays a dual function in transcription and stabilization of specific chloroplast transcripts within the psbE and ndhH operons. New Phytologist, 227(5), 1376-1391.
2. Pesaresi, P., Varotto, C., Meurer, J., Jahns, P., Salamini, F., & Leister, D. (2001). Knock-out of the plastid ribosomal protein L11 in Arabidopsis: effects on mRNA translation and photosynthesis. The Plant Journal, 27(3), 179-189.
3. Hegeman, C. E., Hayes, M. L., & Hanson, M. R. (2005). Substrate and cofactor requirements for RNA editing of chloroplast transcripts in Arabidopsis in vitro. The Plant Journal, 42(1), 124-132.
For Research Use Only | Not For Clinical Use.
Online Inquiry