AibGenesis™ Mouse Anti-PSBF Antibody (CBMOAB-39417FYC)
Cat: CBMOAB-39417FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-39417FYC | Monoclonal | WB, ELISA | MO39417FC | 100 µg | |||
| CBMOAB-88933FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO88933FYB | 100 µg | ||
| MO-AB-00512W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00512W | 100 µg | ||
| MO-AB-01908L | Monoclonal | Bromus (Bromus vulgaris) | WB, ELISA | MO01908L | 100 µg | ||
| MO-AB-27985W | Monoclonal | Cottonwood (Populus deltoids) | WB, ELISA | MO27985W | 100 µg | ||
| MO-AB-30490H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30490C | 100 µg | ||
| MO-AB-36421W | Monoclonal | French-bean | WB, ELISA | MO36421W | 100 µg | ||
| MO-DKB-01728W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg | |||
| MO-DKB-0424RA | Polyclonal | WB | 200 µL |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), A. thaliana (Arabidopsis thaliana); P. sativum (Pisum sativum); T. aestivum (Triticum aestivum), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cottonwood (Populus deltoids), French-bean, Rice (Oryza), Sugar beet (Beta vulgaris) |
| Clone | MO39417FC |
| Specificity | This antibody binds to Arabidopsis PSBF. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Chloroplast; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Arabidopsis PSBF Antibody is a mouse antibody against PSBF. It can be used for PSBF detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cytochrome b559 subunit beta; PSII reaction center subunit VI; psbF; AtCg00570 |
| UniProt ID | P62095 |
| Protein Refseq | The length of the protein is 39 amino acids long. The sequence is show below: MTIDRTYPIFTVRWLAVHGLAVPTVSFLGSISAMQFIQR. |
Reference
| Reference | Cai, W., Ji, D., Peng, L., Guo, J., Ma, J., Zou, M., ... & Zhang, L. (2009). LPA66 is required for editing psbF chloroplast transcripts in Arabidopsis. Plant Physiology, 150(3), 1260-1271. |
For Research Use Only | Not For Clinical Use.
Online Inquiry