AibGenesis™ Mouse Anti-PSBJ Antibody (CBMOAB-39422FYC)
Cat: CBMOAB-39422FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-39422FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris) | WB, ELISA | MO39422FC | 100 µg | ||
| CBMOAB-88939FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO88939FYB | 100 µg | ||
| MO-AB-00515W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00515W | 100 µg | ||
| MO-AB-39433W | Monoclonal | Grape (Vitis vinifera) | WB, ELISA | MO39433W | 100 µg | ||
| MO-AB-30493H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30493C | 100 µg | ||
| MO-AB-01910L | Monoclonal | Bromus (Bromus vulgaris) | WB, ELISA | MO01910L | 100 µg | ||
| MO-DKB-01871W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris) |
| Clone | MO39422FC |
| Specificity | This antibody binds to Arabidopsis PSBJ. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Chloroplast; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Arabidopsis PSBJ Antibody is a mouse antibody against PSBJ. It can be used for PSBJ detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Photosystem II reaction center protein J; PSII-J; psbJ; AtCg00550 |
| UniProt ID | P56781 |
| Protein Refseq | The length of the protein is 40 amino acids long. The sequence is show below: MADTTGRIPLWVIGTVAGILVIGLIGIFFYGSYSGLGSSL. |
Reference
| Reference | Williams-Carrier, R., Brewster, C., Belcher, S. E., Rojas, M., Chotewutmontri, P., Ljungdahl, S., & Barkan, A. (2019). The Arabidopsis pentatricopeptide repeat protein LPE1 and its maize ortholog are required for translation of the chloroplast psbJ RNA. The Plant Journal, 99(1), 56-66. |
For Research Use Only | Not For Clinical Use.
Online Inquiry