AibGenesis™ Mouse Anti-PSBK Antibody (CBMOAB-39424FYC)
Cat: CBMOAB-39424FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-39424FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cottonwood (Populus deltoids), French-bean, Rice (Oryza), Sugar beet (Beta vulgaris) | WB, ELISA | MO39424FC | 100 µg | ||
| CBMOAB-88940FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO88940FYB | 100 µg | ||
| MO-AB-00516W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00516W | 100 µg | ||
| MO-AB-00808H | Monoclonal | Arabidopsis (Arabidopsis lyrata) | WB, ELISA | MO00808C | 100 µg | ||
| MO-AB-01911L | Monoclonal | Bromus (Bromus vulgaris) | WB, ELISA | MO01911L | 100 µg | ||
| MO-AB-27987W | Monoclonal | Cottonwood (Populus deltoids) | WB, ELISA | MO27987W | 100 µg | ||
| MO-AB-30494H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30494C | 100 µg | ||
| MO-AB-36423W | Monoclonal | French-bean | WB, ELISA | MO36423W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cottonwood (Populus deltoids), French-bean, Rice (Oryza), Sugar beet (Beta vulgaris) |
| Clone | MO39424FC |
| Specificity | This antibody binds to Arabidopsis PSBK. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Chloroplast; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Arabidopsis PSBK Antibody is a mouse antibody against PSBK. It can be used for PSBK detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Photosystem II reaction center protein K; PSII-K; psbK; AtCg00070 |
| UniProt ID | P56782 |
| Protein Refseq | The length of the protein is 61 amino acids long. The sequence is show below: MLNIFNLICIFFNSTLFSSTFLVAKLPEAYAFLNPIVDVMPVIPLFFLLLAFVWQAAVSFR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry