AibGenesis™ Mouse Anti-PSBN Antibody (CBMOAB-39428FYC)
Cat: CBMOAB-39428FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-39428FYC | Monoclonal | WB, ELISA | MO39428FC | 100 µg | |||
| CBMOAB-88945FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO88945FYB | 100 µg | ||
| MO-AB-00519W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00519W | 100 µg | ||
| MO-AB-30497H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30497C | 100 µg | ||
| MO-AB-39436W | Monoclonal | Grape (Vitis vinifera) | WB, ELISA | MO39436W | 100 µg | ||
| MO-DKB-0426RA | Polyclonal | WB | 50 µL |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), A. thaliana (Arabidopsis thaliana); N. tabacum (Nicotiana tabacum), Barrel medic (Medicago truncatula), Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris) |
| Clone | MO39428FC |
| Specificity | This antibody binds to Arabidopsis PSBN. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Chloroplast; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | May play a role in photosystem I and II biogenesis. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Arabidopsis PSBN Antibody is a mouse antibody against PSBN. It can be used for PSBN detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein PsbN; psbN; AtCg00700 |
| UniProt ID | Q7HIW7 |
| Protein Refseq | The length of the protein is 43 amino acids long. The sequence is show below: METATLVAIFISGLLVSFTGYALYTAFGQPSQQLRDPFEEHGD. |
Reference
| Reference | Williams-Carrier, R., Brewster, C., Belcher, S. E., Rojas, M., Chotewutmontri, P., Ljungdahl, S., & Barkan, A. (2019). The Arabidopsis pentatricopeptide repeat protein LPE1 and its maize ortholog are required for translation of the chloroplast psbJ RNA. The Plant Journal, 99(1), 56-66. |
For Research Use Only | Not For Clinical Use.
Online Inquiry