AibGenesis™ Mouse Anti-PSK4 Antibody (CBMOAB-39452FYC)
Cat: CBMOAB-39452FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-39452FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Rice (Oryza), Soybean (Glycine max), Tomato (Lycopersicon esculentum) | WB, ELISA | MO39452FC | 100 µg | ||
| CBMOAB-88956FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO88956FYB | 100 µg | ||
| MO-AB-32298H | Monoclonal | Soybean (Glycine max) | WB, ELISA | MO32298C | 100 µg | ||
| MO-AB-35087H | Monoclonal | Tomato (Lycopersicon esculentum) | WB, ELISA | MO35087C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Rice (Oryza), Soybean (Glycine max), Tomato (Lycopersicon esculentum) |
| Clone | MO39452FC |
| Specificity | This antibody binds to Arabidopsis PSK4. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Promotes plant cell differentiation, organogenesis and somatic embryogenesis as well as cell proliferation. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Arabidopsis PSK4 Antibody is a mouse antibody against PSK4. It can be used for PSK4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Putative phytosulfokines 4; AtPSK4; [Cleaved into: Phytosulfokine-alpha-like (PSK-alpha-like) (Phytosulfokine-a-like); Phytosulfokine-beta (PSK-beta) (Phytosulfokine-b)]; PSK4; At4g37720 |
| UniProt ID | Q9SZG4 |
| Protein Refseq | The length of the protein is 87 amino acids long. The sequence is show below: MANLSTLITIALLLCATMLTCSARPEPAYFASFTTSPADTLSLEMIESKLHEVAGESCDKEDDEDCLVRRTLTAHLDYIYTHKNNHH. |
For Research Use Only | Not For Clinical Use.
Online Inquiry