AibGenesis™ Mouse Anti-PSK5 Antibody (CBMOAB-39453FYC)
Cat: CBMOAB-39453FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-39453FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Rice (Oryza), Soybean (Glycine max) | WB, ELISA | MO39453FC | 100 µg | ||
| CBMOAB-88957FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO88957FYB | 100 µg | ||
| MO-AB-32299H | Monoclonal | Soybean (Glycine max) | WB, ELISA | MO32299C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Rice (Oryza), Soybean (Glycine max) |
| Clone | MO39453FC |
| Specificity | This antibody binds to Arabidopsis PSK5. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Promotes plant cell differentiation, organogenesis and somatic embryogenesis as well as cell proliferation. May be involved in the low quiescent center cell proliferation. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Arabidopsis PSK5 Antibody is a mouse antibody against PSK5. It can be used for PSK5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Phytosulfokines 5; AtPSK5; [Cleaved into: Phytosulfokine-alpha (PSK-alpha) (Phytosulfokine-a); Phytosulfokine-beta (PSK-beta) (Phytosulfokine-b)]; PSK5; At5g65870 |
| UniProt ID | Q9FEB4 |
| Protein Refseq | The length of the protein is 77 amino acids long. The sequence is show below: MVKFTTFLCIIALLLCSTLTHASARLNPTSVYPEENSFKKLEQGEVICEGVGEEECFLIRRTLVAHTDYIYTQNHNP. |
For Research Use Only | Not For Clinical Use.
Online Inquiry