AibGenesis™ Mouse Anti-PSMF1 Antibody (CBMOAB-55607FYA)


Cat: CBMOAB-55607FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55607FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO55607FYA 100 µg
CBMOAB-94335FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO94335FYA 100 µg
MO-AB-06678H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06678C 100 µg
MO-AB-12131W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12131W 100 µg
MO-AB-18754R Monoclonal Cattle (Bos taurus) WB, ELISA MO18754R 100 µg
MO-AB-62495W Monoclonal Marmoset WB, ELISA MO62495W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO55607FYA
SpecificityThis antibody binds to Rhesus PSMF1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Endoplasmic reticulum; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PSMF1 Antibody is a mouse antibody against PSMF1. It can be used for PSMF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPSMF1
UniProt IDF6RDS8
Protein RefseqThe length of the protein is 106 amino acids long.
The sequence is show below: IREQWEKASVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWHRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPG.
For Research Use Only | Not For Clinical Use.
Online Inquiry