AibGenesis™ Mouse Anti-PSMG4 Antibody (CBMOAB-55614FYA)


Cat: CBMOAB-55614FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55614FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO55614FYA 100 µg
MO-AB-16053W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16053W 100 µg
MO-AB-28167H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28167C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO55614FYA
SpecificityThis antibody binds to Rhesus PSMG4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PSMG4 Antibody is a mouse antibody against PSMG4. It can be used for PSMG4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPSMG4
UniProt IDF7GQP4
Protein RefseqThe length of the protein is 129 amino acids long.
The sequence is show below: ESALGVSVLAPSGLAGPAAARTRVAPGAVGRHGGSGCRRRRGRLPAQLQRQAVGAAGPLPRHAADGLAVPVGGGHAAPAQPGGGHVQPLPRKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF.
For Research Use Only | Not For Clinical Use.
Online Inquiry