AibGenesis™ Mouse Anti-Ptms Antibody (MO-AB-28188H)


Cat: MO-AB-28188H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-28188H Monoclonal Rat (Rattus norvegicus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO28188C 100 µg
CBMOAB-55700FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO55700FYA 100 µg
MO-AB-19407W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19407W 100 µg
MO-AB-62553W Monoclonal Marmoset WB, ELISA MO62553W 100 µg
MO-AB-18814R Monoclonal Cattle (Bos taurus) WB, ELISA MO18814R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta)
CloneMO28188C
SpecificityThis antibody binds to Rat Ptms.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against Ptms. It can be used for Ptms detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesParathymosin; Ptms
UniProt IDB3DM95
Protein RefseqThe length of the protein is 102 amino acids long.
The sequence is show below: MSEKSVEAAAELSAKDLKEKKDKVEEKAGRKERKKEVVEEEENGAEEEEEETAEDGEDDDEGDEEDEEEEEEEDEGPVRKRTAEEEDEADPKRQKTENGASA.
For Research Use Only | Not For Clinical Use.
Online Inquiry