AibGenesis™ Mouse Anti-PTPLB Antibody (CBMOAB-55716FYA)


Cat: CBMOAB-55716FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55716FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO55716FYA 100 µg
CBMOAB-94515FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO94515FYA 100 µg
MO-AB-62568W Monoclonal Marmoset WB, ELISA MO62568W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO55716FYA
SpecificityThis antibody binds to Rhesus PTPLB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PTPLB Antibody is a mouse antibody against PTPLB. It can be used for PTPLB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names3-hydroxyacyl-CoA dehydratase 2; PTPLB
UniProt IDH9F8R2
Protein RefseqThe length of the protein is 252 amino acids long.
The sequence is show below: AAAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGLVRAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAVTHSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVSGELLTIYAALPFVRQAGLYSISLPNKYNFSFDYHAFLILIMISYIPIFPQLYFHMIHQRRKILSHTEEHKKFE.
For Research Use Only | Not For Clinical Use.
Online Inquiry