AibGenesis™ Mouse Anti-ptrhd1 Antibody (CBMOAB-94732FYA)


Cat: CBMOAB-94732FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-94732FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO94732FYA 100 µg
MO-AB-06740H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06740C 100 µg
MO-AB-18673W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18673W 100 µg
MO-AB-18844R Monoclonal Cattle (Bos taurus) WB, ELISA MO18844R 100 µg
MO-AB-28207H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28207C 100 µg
MO-AB-62661W Monoclonal Marmoset WB, ELISA MO62661W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO94732FYA
SpecificityThis antibody binds to Zebrafish ptrhd1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ptrhd1 Antibody is a mouse antibody against ptrhd1. It can be used for ptrhd1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesptrhd1; si:dkey-34f16.5
UniProt IDQ5RIN6
Protein RefseqThe length of the protein is 126 amino acids long.
The sequence is show below: MATPGSGSSRRLVQYVIVRSDLIHSLSWPLGAVITQACHAATAAIHLHYSDPDTQQYLAELDSMHKVVLQAPDEASLSTLSSTLEEKDIAHKLWMEQPENIPTCLALKPYPKETVQPYLKKFKLFK.
For Research Use Only | Not For Clinical Use.
Online Inquiry