Mouse Anti-Purple sea urchin eif4e2 Antibody (MO-AB-30639H)


Cat: MO-AB-30639H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPurple sea urchin (Strongylocentrotus purpuratus)
CloneMO30639C
SpecificityThis antibody binds to Purple sea urchin eif4e2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionEIF4E2 (Eukaryotic Translation Initiation Factor 4E Family Member 2) is a protein coding gene. Among its related pathways are Cytokine Signaling in Immune system and Transport of the SLBP independent Mature mRNA. Gene Ontology (GO) annotations related to this gene include ubiquitin protein ligase binding. An important paralog of this gene is EIF4E.
Product OverviewThis product is a mouse antibody against eif4e2. It can be used for eif4e2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEukaryotic translation initiation factor 4E member 2; eif4e2; Sp-4Ehp
UniProt IDA3KLJ3
Protein RefseqThe length of the protein is 227 amino acids long.
The sequence is show below: MTVQLKDDDSGEEREEVQIEPSLNKDDIEDPHQIEWPTVKCKQGEHQLQYSYCVWFSRRTPGNKASSANYEQNIKIIGSFASVEQFWTLYSHIARPCDLTSSSDYHLFKHGIKPMWEDEANKKGGKWIVRLRKGLASRLWENLVIAMLGEQFMVGEEICGAVVSVRFAEDIISIWNRTASDNSINIRVRDTLQRVLNLPPNTIMEYKTHTDSLKDRSSFRNTDVFMR.
For Research Use Only | Not For Clinical Use.
Online Inquiry