Mouse Anti-Tomato eIF4E2 Antibody (MO-AB-34411H)
Cat: MO-AB-34411H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Tomato (Lycopersicon esculentum) |
Clone | MO34411C |
Specificity | This antibody binds to Tomato eIF4E2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | EIF4E2 (Eukaryotic Translation Initiation Factor 4E Family Member 2) is a protein coding gene. Among its related pathways are Cytokine Signaling in Immune system and Transport of the SLBP independent Mature mRNA. Gene Ontology (GO) annotations related to this gene include ubiquitin protein ligase binding. An important paralog of this gene is EIF4E. |
Product Overview | This product is a mouse antibody against eIF4E2. It can be used for eIF4E2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Translation initiation factor eIF4E2; eIF4E2 |
UniProt ID | C9E257 |
Protein Refseq | The length of the protein is 85 amino acids long. The sequence is show below: MADELNKAALEEYKSSSVEDRGEEGEIVGESDDTASSLGKQITMKHPLEHSWTFWFDNPSGKSKQAAWGSSIRPIYTFSTAEDFW. |
See other products for " EIF4E2 "
MO-AB-11939R | Mouse Anti-Cattle EIF4E2 Antibody (MO-AB-11939R) |
MO-AB-54829W | Mouse Anti-Marmoset EIF4E2 Antibody (MO-AB-54829W) |
MO-AB-20977W | Mouse Anti-Chimpanzee EIF4E2 Antibody (MO-AB-20977W) |
MO-AB-25616H | Mouse Anti-Rat Eif4e2 Antibody (MO-AB-25616H) |
MO-AB-30639H | Mouse Anti-Purple sea urchin eif4e2 Antibody (MO-AB-30639H) |
CBMOAB-74748FYA | Mouse Anti-Zebrafish eif4e2 Antibody (CBMOAB-74748FYA) |
MO-AB-03242H | Mouse Anti-Frog eif4e2 Antibody (MO-AB-03242H) |
CBMOAB-41631FYA | Mouse Anti-Rhesus EIF4E2 Antibody (CBMOAB-41631FYA) |
CBMOAB-28180FYC | Mouse Anti-Arabidopsis EIF4E2 Antibody (CBMOAB-28180FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry