AibGenesis™ Mouse Anti-pvalb2 Antibody (CBMOAB-94792FYA)


Cat: CBMOAB-94792FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-94792FYA Monoclonal Zebrafish (Danio rerio), O. mykiss (Oncorhynchus mykiss) WB, ELISA MO94792FYA 100 µg
MO-AB-12931Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO12931Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), O. mykiss (Oncorhynchus mykiss)
CloneMO94792FYA
SpecificityThis antibody binds to Zebrafish pvalb2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionIn muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish pvalb2 Antibody is a mouse antibody against pvalb2. It can be used for pvalb2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesParvalbumin-2; Parvalbumin beta; pvalb2; pvalb pvalb
UniProt IDQ9I8V0
Protein RefseqThe length of the protein is 109 amino acids long.
The sequence is show below: MAFAGILKDEDVAAALKDCAAADSFNYKNFFAKVGLSAKSPDDIKKAFFVIDQDKSGFIEEDELKLFLQNFSAGARALTDAETKAFLSAGDSDGDGKIGVDEFALLVKA.
For Research Use Only | Not For Clinical Use.
Online Inquiry