AibGenesis™ Mouse Anti-PXMP4 Antibody (CBMOAB-55797FYA)


Cat: CBMOAB-55797FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55797FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO55797FYA 100 µg
MO-AB-10765W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10765W 100 µg
MO-AB-18869R Monoclonal Cattle (Bos taurus) WB, ELISA MO18869R 100 µg
MO-AB-28218H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28218C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO55797FYA
SpecificityThis antibody binds to Rhesus PXMP4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PXMP4 Antibody is a mouse antibody against PXMP4. It can be used for PXMP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPXMP4
UniProt IDF7DEH6
Protein RefseqThe length of the protein is 128 amino acids long.
The sequence is show below: MAAPPQLRALLVAVNALLRKRRYHAALAVLKGFRNGAVYGAKIRAPHALVMTFLFRNGSLQEKLWAILQATYMHSWNLAWFVFTYKGLRALQSRIQGKTYPAHAFLAAFLGGILVFGENNNINSQVKI.
For Research Use Only | Not For Clinical Use.
Online Inquiry