AibGenesis™ Mouse Anti-QRFP Antibody (MO-AB-18897R)


Cat: MO-AB-18897R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-18897R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO18897R 100 µg
MO-AB-28226H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28226C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO18897R
SpecificityThis antibody binds to Cattle QRFP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. The encoded products are members of the RFamide family of neuropeptides, characterized by their common protein C-terminus consisting of an arginine (R) and an amidated phenylalanine (F). These products include the neuropeptides 26RFa and the N-terminally extended form, 43RFa. Both of these neuropeptides bind to the pyroglutamylated RFamide peptide receptor (QRFPR) and may regulate blood pressure, reproduction and food intake in rodents. (From NCBI)
Product OverviewThis product is a mouse antibody against QRFP. It can be used for QRFP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOrexigenic neuropeptide QRFP; [Cleaved into: QRF-amide (Neuropeptide RF-amide) (Pyroglutamylated arginine-phenylalanine-amide peptide)]; QRFP
UniProt IDP83862
Protein RefseqThe length of the protein is 134 amino acids long.
The sequence is show below: MRSPYSLPYLLFLPLGACFPVLDTEEPVDAVGGTGREMSWMDPARGRPFPWGSPGWPRAPYPHALLVTAKELRASGKARAGFQLRLGRQDDGSEATGLLLGEAEKVGGLLGTLAEELNGYSRKKGGFSFRFGRR.
For Research Use Only | Not For Clinical Use.
Online Inquiry