AibGenesis™ Mouse Anti-rab18b Antibody (CBMOAB-94970FYA)


Cat: CBMOAB-94970FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-94970FYA Monoclonal Zebrafish (Danio rerio), Zebrafish WB, ELISA MO94970FYA 100 µg
MOFY-1222-FY2 Polyclonal Zebrafish WB, IHC, ICC, IF, ELISA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Zebrafish
CloneMO94970FYA
SpecificityThis antibody binds to Zebrafish rab18b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish rab18b Antibody is a mouse antibody against rab18b. It can be used for rab18b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRas-related protein Rab-18-B; rab18b; rab1
UniProt IDQ6DHC1
Protein RefseqThe length of the protein is 205 amino acids long.
The sequence is show below: MDDDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTIAIDGNRAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTKRDTFTKLENWLNELETYCTRNDLVKMLVGNKIDKDNREVDRNEGLKFARKHSMLFIEASAKTRDGVQCAFEELVEKILQTPGLWESSIQNHGVQLSDNEPQRQGACGGYCSLV.
For Research Use Only | Not For Clinical Use.
Online Inquiry