AibGenesis™ Mouse Anti-RAB34 Antibody (MO-AB-18935R)


Cat: MO-AB-18935R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-18935R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO18935R 100 µg
Inquiry
MO-AB-28276H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28276C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO18935R
SpecificityThis antibody binds to Cattle RAB34.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein belonging to the RAB family of proteins, which are small GTPases involved in protein transport. This family member is a Golgi-bound member of the secretory pathway that is involved in the repositioning of lysosomes and the activation of macropinocytosis. Alternative splicing of this gene results in multiple transcript variants. An alternatively spliced transcript variant produces the nine-amino acid residue-repeats (NARR) protein, which is a functionally distinct nucleolar protein resulting from a different reading frame. (From NCBI)
Product OverviewThis product is a mouse antibody against RAB34. It can be used for RAB34 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRAB34, member RAS oncogene family; RAB34
UniProt IDQ3ZBE4
Protein RefseqThe length of the protein is 267 amino acids long.
The sequence is show below: MNILAPVRRDRVLTKLPQCLRKEAALHVHKDFQPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLINRFCKDTFDKNYKATIGVDFEMERFEVLGVPFSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASLEHTKQWLADALKENDPSSVLLFLVGSKKDLSVSVPVVGEDFTSRQGKPHAQHLTLTFLQTPAQYILMEKDALKVAQEMKAEYWAVSSLTGESEAPGLPACLASHSYTSSCAPRPG.
For Research Use Only | Not For Clinical Use.
Online Inquiry