AibGenesis™ Mouse Anti-rab5if Antibody (MO-AB-06828H)


Cat: MO-AB-06828H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06828H Monoclonal Frog (Xenopus laevis), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO06828C 100 µg
MO-AB-23758W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23758W 100 µg
MO-AB-28295H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28295C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO06828C
SpecificityThis antibody binds to Frog rab5if.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against rab5if. It can be used for rab5if detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC80227 protein; MGC80227
UniProt IDQ6DE34
Protein RefseqThe length of the protein is 127 amino acids long.
The sequence is show below: MSGKRKEEQPVSNGGVKVKGPLWSKALRGDSTWEDKDEFLDVIYWFRQILAIVLGVIWGVAPLKGFIGIIIFCLINAGVLYLYFSSFQQIDEEEYGGTWELTKEGFMTSFALFMVVWIIFYTAIHYD.
For Research Use Only | Not For Clinical Use.
Online Inquiry