Mouse Anti-Rabbit EIF6 Antibody (MO-AB-07998Y)
Cat: MO-AB-07998Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rabbit (Oryctolagus cuniculus) |
Clone | MO07998Y |
Specificity | This antibody binds to Rabbit EIF6. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Nucleus; Cytoskeleton |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit to form the 80S initiation complex in the cytoplasm. Behaves as a stimulatory translation initiation factor downstream insulin/growth factors. Is also involved in ribosome biogenesis. Associates with pre-60S subunits in the nucleus and is involved in its nuclear export. Cytoplasmic release of TIF6 from 60S subunits and nuclear relocalization is promoted by a RACK1 (RACK1)-dependent protein kinase C activity. In tissues responsive to insulin, controls fatty acid synthesis and glycolysis by exerting translational control of adipogenic transcription factors such as CEBPB, CEBPD and ATF4 that have G/C rich or uORF in their 5'UTR. Required for ROS-dependent megakaryocyte maturation and platelets formation, controls the expression of mitochondrial respiratory chain genes involved in reactive oxygen species (ROS) synthesis. Involved in miRNA-mediated gene silencing by the RNA-induced silencing complex (RISC). Required for both miRNA-mediated translational repression and miRNA-mediated cleavage of complementary mRNAs by RISC. Modulates cell cycle progression and global translation of pre-B cells, its activation seems to be rate-limiting in tumorigenesis and tumor growth. |
Product Overview | This product is a mouse antibody against EIF6. It can be used for EIF6 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Eukaryotic translation initiation factor 6; eIF-6; EIF6; ITGB4BP LOC100344140 |
UniProt ID | B7NZI5 |
Protein Refseq | The length of the protein is 254 amino acids long. The sequence is show below: MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNCLPDSVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCIFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEGQPSTLATSMRDSLIDSANEGAPWRRRP. |
See other products for " eif6 "
CBMOAB-74793FYA | Mouse Anti-Zebrafish eif6 Antibody (CBMOAB-74793FYA) |
MO-AB-38541W | Mouse Anti-Gorilla EIF6 Antibody (MO-AB-38541W) |
MO-AB-41606W | Mouse Anti-Guinea pig EIF6 Antibody (MO-AB-41606W) |
MO-AB-27546W | Mouse Anti-Cottonwood EIF6 Antibody (MO-AB-27546W) |
MO-AB-11307Y | Mouse Anti-O. mykiss EIF6 Antibody (MO-AB-11307Y) |
MO-AB-15157Y | Mouse Anti-Sheep EIF6 Antibody (MO-AB-15157Y) |
MO-AB-39012W | Mouse Anti-Grape EIF6 Antibody (MO-AB-39012W) |
MO-AB-30641H | Mouse Anti-Purple sea urchin EIF6 Antibody (MO-AB-30641H) |
MO-AB-33068H | Mouse Anti-Nile tilapia EIF6 Antibody (MO-AB-33068H) |
MO-AB-00444H | Mouse Anti-Arabidopsis EIF6 Antibody (MO-AB-00444H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry