Mouse Anti-Grape EIF6 Antibody (MO-AB-39012W)
Cat: MO-AB-39012W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Grape (Vitis vinifera) |
Clone | MO39012W |
Specificity | This antibody binds to Grape EIF6. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Cytosol; Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple non-protein coding transcript variants and variants encoding two different isoforms have been found for this gene. |
Product Overview | Mouse Anti-Grape EIF6 Antibody is a mouse antibody against EIF6. It can be used for EIF6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Eukaryotic translation initiation factor 6; eIF-6; EIF6; VIT_07s0031g02300 |
UniProt ID | A5BR49 |
Protein Refseq | The length of the protein is245 amino acids long. The sequence is show below: MATRLQFENSCEVGVFSKLTNAYCLVAIGGSESFYSVFESELADVIPVVKTSIGGTRIIGRLCAGNKKGLLLPHTTTDQELQHLRNSLPDQVVVQRIEEKLSALGNCIACNDHVALAHTDLDRETEEMVADVLGVEVFRQTIAGNILVGSYCTFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIAAGMTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSLIDSYV. |
See other products for " EIF6 "
MO-AB-30641H | Mouse Anti-Purple sea urchin EIF6 Antibody (MO-AB-30641H) |
MO-AB-41606W | Mouse Anti-Guinea pig EIF6 Antibody (MO-AB-41606W) |
MO-AB-07998Y | Mouse Anti-Rabbit EIF6 Antibody (MO-AB-07998Y) |
MO-AB-00444H | Mouse Anti-Arabidopsis EIF6 Antibody (MO-AB-00444H) |
CBMOAB-74793FYA | Mouse Anti-Zebrafish eif6 Antibody (CBMOAB-74793FYA) |
MO-AB-14358W | Mouse Anti-Chimpanzee EIF6 Antibody (MO-AB-14358W) |
MO-AB-34715W | Mouse Anti-Ferret EIF6 Antibody (MO-AB-34715W) |
MO-AB-33068H | Mouse Anti-Nile tilapia EIF6 Antibody (MO-AB-33068H) |
MO-AB-11951R | Mouse Anti-Cattle EIF6 Antibody (MO-AB-11951R) |
MO-DKB-03388W | Rabbit Anti-EIF6 (Center) Antibody (Cat MO-DKB-03388W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry