Mouse Anti-Rabbit SNAP25 Antibody (MO-AB-10043Y)


Cat: MO-AB-10043Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRabbit (Oryctolagus cuniculus)
CloneMO10043Y
SpecificityThis antibody binds to Rabbit SNAP25.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Introductiont-SNARE involved in the molecular regulation of neurotransmitter release. May play an important role in the synaptic function of specific neuronal systems. Associates with proteins involved in vesicle docking and membrane fusion. Regulates plasma membrane recycling through its interaction with CENPF. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1 in pancreatic beta cells.
Product OverviewThis product is a mouse antibody against SNAP25. It can be used for SNAP25 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesSynaptosomal-associated protein 25; SNAP-25; Super protein; SUP; Synaptosomal-associated 25 kDa proteins; SNAP25; SNAP
UniProt IDP55820
Protein RefseqThe length of the protein is 54 amino acids long. The sequence is show below: MLQLVEESSKDAGIRXLVMLDEQGEQLERVVDEREQMAISGGFIRIMEKMLGSG.
See other products for " snap25 "
MO-AB-07861HMouse Anti-Frog snap25 Antibody (MO-AB-07861H)
MO-AB-11595WMouse Anti-Chimpanzee SNAP25 Antibody (MO-AB-11595W)
MOFAB-426WRabbit Anti-SNAP25 Antibody (MOFAB-426W)
MO-AB-29055HMouse Anti-Rat Snap25 Antibody (MO-AB-29055H)
MO-DKB-03465WRabbit Anti-SNAP25 (C-terminal) Antibody (Cat MO-DKB-03465W)
MO-AB-01430LMouse Anti-Elephant SNAP25 Antibody (MO-AB-01430L)
MO-AB-33466WMouse Anti-Dog SNAP25 Antibody (MO-AB-33466W)
MO-AB-17737YMouse Anti-Sheep SNAP25 Antibody (MO-AB-17737Y)
MO-AB-46624WMouse Anti-Horse SNAP25 Antibody (MO-AB-46624W)
MO-AB-33810HMouse Anti-Nile tilapia snap25 Antibody (MO-AB-33810H)
For Research Use Only | Not For Clinical Use.
Online Inquiry