AibGenesis™ Mouse Anti-RABL5 Antibody (CBMOAB-55949FYA)


Cat: CBMOAB-55949FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55949FYA Monoclonal Rhesus (Macaca mulatta), Marmoset WB, ELISA MO55949FYA 100 µg
MO-AB-05495W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05495W 100 µg
MO-AB-62859W Monoclonal Marmoset WB, ELISA MO62859W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset
CloneMO55949FYA
SpecificityThis antibody binds to Rhesus RABL5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RABL5 Antibody is a mouse antibody against RABL5. It can be used for RABL5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRABL5
UniProt IDF6PS43
Protein RefseqThe length of the protein is 155 amino acids long.
The sequence is show below: MLKAKILFVGPCESGKTVLANFLTESSDITEYSPTQGVRFESCWPALMKDAHGVVIIFNADIPSHRKEMEMWYSCFVQQQSLQDTQCMLIAHHKPGSGDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIMT.
For Research Use Only | Not For Clinical Use.
Online Inquiry