AibGenesis™ Mouse Anti-RAD21L1 Antibody (CBMOAB-55961FYA)


Cat: CBMOAB-55961FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55961FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO55961FYA 100 µg
CBMOAB-95129FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO95129FYA 100 µg
MO-AB-05496W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05496W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO55961FYA
SpecificityThis antibody binds to Rhesus RAD21L1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RAD21L1 Antibody is a mouse antibody against RAD21L1. It can be used for RAD21L1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRAD21L1
UniProt IDF7F2L1
Protein RefseqThe length of the protein is 158 amino acids long.
The sequence is show below: MFYTHVLMSKRGPLAKIWLAAHWEKKLTKAHVFECNLEITIEKILSPKVKIALRTSGHLLLGVVRIYNRKAKYLLADCSEAFLKMKMTFRPGLVDLPKENFEASYNAITLPEEFHDFDTQNMNAIDVSEHFTQNQSRPEEITLRENFDKDLLLQAESF.
For Research Use Only | Not For Clinical Use.
Online Inquiry