AibGenesis™ Mouse Anti-rasd2 Antibody (MO-AB-06938H)


Cat: MO-AB-06938H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06938H Monoclonal Frog (Xenopus laevis), Cattle (Bos taurus), Marmoset WB, ELISA MO06938C 100 µg
MO-AB-19064R Monoclonal Cattle (Bos taurus) WB, ELISA MO19064R 100 µg
MO-AB-62973W Monoclonal Marmoset WB, ELISA MO62973W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Cattle (Bos taurus), Marmoset
CloneMO06938C
SpecificityThis antibody binds to Frog rasd2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the Ras superfamily of small GTPases and is enriched in the striatum. The encoded protein functions as an E3 ligase for attachment of small ubiquitin-like modifier (SUMO). This protein also binds to mutant huntingtin (mHtt), the protein mutated in Huntington disease (HD). Sumoylation of mHTT by this protein may cause degeneration of the striatum. The protein functions as an activator of mechanistic target of rapamycin 1 (mTOR1), which in turn plays a role in myelination, axon growth and regeneration. Reduced levels of mRNA expressed by this gene were found in HD patients. (From NCBI)
Product OverviewThis product is a mouse antibody against rasd2. It can be used for rasd2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC81985 protein; rasd2; MGC81985
UniProt IDQ6GM99
Protein RefseqThe length of the protein is 266 amino acids long.
The sequence is show below: MMKTLSSGNCTLSVPAKNSYRMVVLGASKVGKSAIVARFLNGRFEDQYTPTIEDFHRKLYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSIDNRDSFDEVKRLRKQILEVKSCVKNKTKETGEFPMMICGNKSDYGEHHRKVRAEEAERLVSGDENCAYFEISAKKNVNVDKMFQVLFSMAKLPNEMSPALHRKISMQIGDTFHQKSFRLRRLKEVDAYGMVSPSARRPSVNSDLKYIKSKVLGEGQGRDREKCSIQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry