AibGenesis™ Mouse Anti-rasl10b Antibody (MO-AB-06943H)


Cat: MO-AB-06943H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06943H Monoclonal Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO06943C 100 µg
MO-AB-28358H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28358C 100 µg
MO-AB-62987W Monoclonal Marmoset WB, ELISA MO62987W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO06943C
SpecificityThis antibody binds to Frog rasl10b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against rasl10b. It can be used for rasl10b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRasl10b protein; rasl10b
UniProt IDA1L104
Protein RefseqThe length of the protein is 203 amino acids long.
The sequence is show below: MVTTFKIAVLGAQGVGKTAIVRQFMYNEFNEACVPTNARRVFLPAVVMNGHVHELQIMDFPPITSFPVNTLQEWADSCCRGLRSAHAYILVYDICCFDSFEYIKTLRQQILETRVIGTTETPIIIVGNKRDLQRGRVFPRWNVSHLVKKTWKCGYIECSAKYNWHILLLFSELLKSVGCARCKHVHAAIRFQGALRRNRCSIM.
For Research Use Only | Not For Clinical Use.
Online Inquiry