Mouse Anti-Rat ABCA1 Antibody (MO-AB-23933H)
Cat: MO-AB-23933H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO23933C |
Specificity | This antibody binds to Rat ABCA1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. With cholesterol as its substrate, this protein functions as a cholesteral efflux pump in the cellular lipid removal pathway. Mutations in this gene have been associated with Tangier's disease and familial high-density lipoprotein deficiency. |
Product Overview | This product is a mouse antibody against ABCA1. It can be used for ABCA1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Atp casette transporter A1; ABCA1 |
UniProt ID | A8J6V3 |
Protein Refseq | The length of the protein is 73 amino acids long. The sequence is show below: MACWSQLRLLLWKNLTFRRRQTCQLLLEVAWPLFIFLILISVRLSYPPYEQHECHFPNKAMPSAGTLPWVQGI. |
See other products for " ABCA1 "
MO-AB-43541W | Mouse Anti-Horse ABCA1 Antibody (MO-AB-43541W) |
CBMOAB-1248FYC | Mouse Anti-Arabidopsis ABCA1 Antibody (CBMOAB-1248FYC) |
CBMOAB-34770FYA | Mouse Anti-Rhesus ABCA1 Antibody (CBMOAB-34770FYA) |
MO-AB-11317W | Mouse Anti-Chimpanzee ABCA1 Antibody (MO-AB-11317W) |
MO-AB-23439R | Mouse Anti-Pig ABCA1 Antibody (MO-AB-23439R) |
MO-AB-00011Y | Mouse Anti-Chicken ABCA1 Antibody (MO-AB-00011Y) |
MO-AB-50177W | Mouse Anti-Marmoset ABCA1 Antibody (MO-AB-50177W) |
MO-AB-03326W | Mouse Anti-Rhesus ABCA1 Antibody (MO-AB-03326W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry