Mouse Anti-Rat apoB Antibody (MO-AB-24112H)


Cat: MO-AB-24112H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO24112C
SpecificityThis antibody binds to Rat apoB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene product is the main apolipoprotein of chylomicrons and low density lipoproteins. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver. The intestinal and the hepatic forms of apoB are encoded by a single gene from a single, very long mRNA. The two isoforms share a common N-terminal sequence. The shorter apoB-48 protein is produced after RNA editing of the apoB-100 transcript at residue 2180 (CAA->UAA), resulting in the creation of a stop codon, and early translation termination. Mutations in this gene or its regulatory region cause hypobetalipoproteinemia, normotriglyceridemic hypobetalipoproteinemia, and hypercholesterolemia due to ligand-defective apoB, diseases affecting plasma cholesterol and apoB levels.
Product OverviewThis product is a mouse antibody against apoB. It can be used for apoB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesApolipoprotein B; apoB
UniProt IDQ63051
Protein RefseqThe length of the protein is 80 amino acids long.
The sequence is show below: LSRLLQQIHDYLNASDWERQVAGAKEKINFFMENYRITDNDLLIALDSAKINLNEKLSQLETYAIQFDQYIRDNYDAQDL.
For Research Use Only | Not For Clinical Use.
Online Inquiry