Mouse Anti-Rat Bcas2 Antibody (MO-AB-24334H)


Cat: MO-AB-24334H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO24334C
SpecificityThis antibody binds to Rat Bcas2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. The PRP19-CDC5L complex may also play a role in the response to DNA damage (DDR).
Product OverviewThis product is a mouse antibody against Bcas2. It can be used for Bcas2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBreast carcinoma amplified sequence 2; Protein Bcas2; Breast carcinoma amplified sequence 2, isoform CRA_b; Bcas2
UniProt IDB5DFM8
Protein RefseqThe length of the protein is 225 amino acids long.
The sequence is show below: MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQDCVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGAKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF.
For Research Use Only | Not For Clinical Use.
Online Inquiry