Mouse Anti-Zebrafish bcas2 Antibody (CBMOAB-67527FYA)


Cat: CBMOAB-67527FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO67527FYA
SpecificityThis antibody binds to Zebrafish bcas2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. The PRP19-CDC5L complex may also play a role in the response to DNA damage (DDR).
Product OverviewMouse Anti-Zebrafish bcas2 Antibody is a mouse antibody against bcas2. It can be used for bcas2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPre-mRNA-splicing factor SPF27; Protein BCAS2 homolog; bcas
UniProt IDQ5RKQ0
Protein RefseqThe length of the protein is 225 amino acids long.
The sequence is show below: MAGPASVAGDVFVDALPYFDQGYDATGVREAAAALVEEETRRYRPTKNYLSYLPTPDFSAFETEIMRNEFERLAARQPMELLSMKRYELPAPSSGQKNDMTAWQDCVNNSMAQLEHQAVRIENLELMAQYGTNAWKMSNDNLALMIENSQKELQNVRKEIQDLNWQRKNDQLAGGAKLRELESNWVSLVSKNYEIERAIVQLENEVAQMKQQQGDENKENIRQDF.
For Research Use Only | Not For Clinical Use.
Online Inquiry