Mouse Anti-Rat Cd74 Antibody (MO-AB-24650H)


Cat: MO-AB-24650H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO24650C
SpecificityThis antibody binds to Rat Cd74.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD74 (CD74 Molecule) is a protein coding gene. Diseases associated with CD74 include Undifferentiated Pleomorphic Sarcoma and Mantle Cell Lymphoma. Among its related pathways are Response to elevated platelet cytosolic Ca2+ and Innate Immune System. Gene Ontology (GO) annotations related to this gene include identical protein binding and amyloid-beta binding.
Product OverviewThis product is a mouse antibody against Cd74. It can be used for Cd74 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD74 antigen (Invariant polypeptide of major histocompatibility complex, class II antigen-associated), isoform CRA_c; Cd74 molecule, major histocompatibility complex, class II invariant chain; Cd74
UniProt IDQ6GT70
Protein RefseqThe length of the protein is 216 amino acids long.
The sequence is show below: MDDQRDLISNHEQLPILGQRARAPESNCNRGVLYTSVSVLVALLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKSAKPVSPMRMATPLLMRPLSMDNMLQAPVKNVTKYGNMTQDHVMHLLTKSGPVNYPQLKGSFPENLKHLKNSMNGLDWKVFESWMKQWLLFEMSKNSLEEKQPTQTPPKEPLDMEDPSSGLGVTKQDMGQMFL.
For Research Use Only | Not For Clinical Use.
Online Inquiry