Mouse Anti-Rat cdk4 Antibody (MO-AB-24686H)
Cat: MO-AB-24686H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO24686C |
Specificity | This antibody binds to Rat cdk4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Serine/threonine-protein kinase which, in association with cyclin D-like protein cyd-1, is required for the progression through the G1 phase of the cell cycle during postembryonic development by phosphorylating and inhibiting lin-35 and fzr-1 (PubMed:10518501, PubMed:11684669, PubMed:25562820). In complex with cyd-1, involved in sex determination during gonadogenesis by regulating the asymmetric division of the somatic gonadal precursor cell (SGP) (PubMed:16198291). |
Product Overview | This product is a mouse antibody against cdk4. It can be used for cdk4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cyclin-dependent kinase 4; cdk4 |
UniProt ID | Q71VC8 |
Protein Refseq | The length of the protein is 54 amino acids long. The sequence is show below: STVREVALLRRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLD. |
See other products for " CDK4 "
CBMOAB-01202HCB | Mouse Anti-C. elegans CDK4 Antibody (CBMOAB-01202HCB) |
CBMOAB-38845FYA | Mouse Anti-Rhesus CDK4 Antibody (CBMOAB-38845FYA) |
MO-AB-09978R | Mouse Anti-Cattle CDK4 Antibody (MO-AB-09978R) |
MO-AB-14168W | Mouse Anti-Chimpanzee CDK4 Antibody (MO-AB-14168W) |
MO-AB-30607H | Mouse Anti-Purple sea urchin cdk4 Antibody (MO-AB-30607H) |
CBMOAB-69909FYA | Mouse Anti-Zebrafish cdk4 Antibody (CBMOAB-69909FYA) |
CBMOAB-03283FYA | Mouse Anti-D. melanogaster Cdk4 Antibody (CBMOAB-03283FYA) |
MO-AB-52712W | Mouse Anti-Marmoset CDK4 Antibody (MO-AB-52712W) |
MO-AB-07547Y | Mouse Anti-Rabbit CDK4 Antibody (MO-AB-07547Y) |
MO-DKB-00604W | Rabbit Anti-CDK4 Antibody (MO-DKB-00604W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry