Mouse Anti-Zebrafish cdk4 Antibody (CBMOAB-69909FYA)


Cat: CBMOAB-69909FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO69909FYA
SpecificityThis antibody binds to Zebrafish cdk4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSerine/threonine-protein kinase which, in association with cyclin D-like protein cyd-1, is required for the progression through the G1 phase of the cell cycle during postembryonic development by phosphorylating and inhibiting lin-35 and fzr-1 (PubMed:10518501, PubMed:11684669, PubMed:25562820). In complex with cyd-1, involved in sex determination during gonadogenesis by regulating the asymmetric division of the somatic gonadal precursor cell (SGP) (PubMed:16198291).
Product OverviewMouse Anti-Zebrafish cdk4 Antibody is a mouse antibody against cdk4. It can be used for cdk4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:153726; Zgc:153726 protein; cdk4; zgc:15372
UniProt IDQ08C29
Protein RefseqThe length of the protein is 297 amino acids long.
The sequence is show below: MAQEVGLQYEPVAEIGGGAYGTVYKARDRDSGQFVALKSVRVQTNQDGLPLSTVREVALLKRLEQFDHPNIVRLMDVCATLRTDQETKVTLVFEHVDQDLRAYLEKVPAPGLPVDKIRDLMQQLLCGLAFLHTNRVLHRDLKPENILVTSRGQVKLADFGLARIYSCHMALTPVVVTLWYRSPEVLLQSTYATPVDIWSTGCIFAEMFRRKPLFCGDSEADQLGKIFAVIGLPAEDQWPTDVTLSHHNFSPQSPRPITDCVPDITEKGAELLLKMLTFDPLKRISALNALDHPFFSE.
For Research Use Only | Not For Clinical Use.
Online Inquiry