Mouse Anti-Rat CFTR Antibody (MO-AB-24746H)
Cat: MO-AB-24746H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO24746C |
Specificity | This antibody binds to Rat CFTR. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the ATP-binding cassette (ABC) transporter superfamily. The encoded protein functions as a chloride channel, making it unique among members of this protein family, and controls ion and water secretion and absorption in epithelial tissues. Channel activation is mediated by cycles of regulatory domain phosphorylation, ATP-binding by the nucleotide-binding domains, and ATP hydrolysis. Mutations in this gene cause cystic fibrosis, the most common lethal genetic disorder in populations of Northern European descent. The most frequently occurring mutation in cystic fibrosis, DeltaF508, results in impaired folding and trafficking of the encoded protein. Multiple pseudogenes have been identified in the human genome. |
Product Overview | This product is a mouse antibody against CFTR. It can be used for CFTR detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | CFTR protein; CFTR |
UniProt ID | Q9Z0P1 |
Protein Refseq | The length of the protein is 66 amino acids long. The sequence is show below: VIEQGNVWQYESLQALLSEKSVFQRALSSSEKMKLFHGRHSSKQKXRTQITAVKERDGGRSARDPA. |
See other products for " CFTR "
MO-AB-23033H | Mouse Anti-Mallard CFTR Antibody (MO-AB-23033H) |
MO-AB-52883W | Mouse Anti-Marmoset CFTR Antibody (MO-AB-52883W) |
MO-AB-07566Y | Mouse Anti-Rabbit CFTR Antibody (MO-AB-07566Y) |
MO-AB-10119R | Mouse Anti-Cattle CFTR Antibody (MO-AB-10119R) |
CBMOAB-39103FYA | Mouse Anti-Rhesus CFTR Antibody (CBMOAB-39103FYA) |
MO-AB-06359Y | Mouse Anti-O. anatinus CFTR Antibody (MO-AB-06359Y) |
MO-AB-34546W | Mouse Anti-Ferret CFTR Antibody (MO-AB-34546W) |
MO-AB-09780W | Mouse Anti-Chimpanzee CFTR Antibody (MO-AB-09780W) |
MO-AB-44031W | Mouse Anti-Horse CFTR Antibody (MO-AB-44031W) |
MO-AB-14546Y | Mouse Anti-Sheep CFTR Antibody (MO-AB-14546Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry