Mouse Anti-Rat Chchd10 Antibody (MO-AB-24755H)


Cat: MO-AB-24755H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO24755C
SpecificityThis antibody binds to Rat Chchd10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a mitochondrial protein that is enriched at cristae junctions in the intermembrane space. It may play a role in cristae morphology maintenance or oxidative phosphorylation. Mutations in this gene cause frontotemporal dementia and/or amyotrophic lateral sclerosis-2. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 7 and 19.
Product OverviewThis product is a mouse antibody against Chchd10. It can be used for Chchd10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCoiled-coil-helix-coiled-coil-helix domain containing 10; Protein Chchd10; Chchd10; MGC105647
UniProt IDQ63ZY8
Protein RefseqThe length of the protein is 138 amino acids long.
The sequence is show below: MPRGSRSAAARPASRPAHPPAHPPPSAPAPAPATSGQPGLMAQMASTAAGVAVGSAVGHVMGSALTSAFSGGSSEPAQPAVQQAPARPASHPLQMGPCAYEIKQFLDCSTTQSDLTLCEGFSEALKQCKYNHGLSSLP.
For Research Use Only | Not For Clinical Use.
Online Inquiry