Mouse Anti-Rat CR1 Antibody (MO-AB-25050H)
Cat: MO-AB-25050H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO25050C |
Specificity | This antibody binds to Rat CR1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CR1 (Complement C3b/C4b Receptor 1 (Knops Blood Group)) is a protein coding gene. Diseases associated with CR1 include Malaria and Plasmodium Falciparum Malaria. Among its related pathways are Creation of C4 and C2 activators and Primary Focal Segmental Glomerulosclerosis FSGS. Gene Ontology (GO) annotations related to this gene include complement component C3b binding and complement component C4b receptor activity. An important paralog of this gene is CSMD1. |
Product Overview | This product is a mouse antibody against CR1. It can be used for CR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Complement receptor type 1; CR1 |
UniProt ID | Q63129 |
Protein Refseq | The length of the protein is 89 amino acids long. The sequence is show below: GYRLIGSSSAMCIISDQSVAWDAEAPICESIPCEIPPSIPNGDFFSPNREDFHYGMVVTYQCNTDARGKKLFNLVGEPSIHCTSNDDQV. |
See other products for " CR1 "
MOFY-0522-FY40 | Mouse Anti-CR1 Antibody (MOFY-0522-FY40) |
MO-AB-26987W | Mouse Anti-Chimpanzee CR1 Antibody (MO-AB-26987W) |
MO-AB-02633H | Mouse Anti-Frog CR1 Antibody (MO-AB-02633H) |
CBMOAB-39840FYA | Mouse Anti-Rhesus CR1 Antibody (CBMOAB-39840FYA) |
MO-AB-01745W | Mouse Anti-Rhesus CR1 Antibody (MO-AB-01745W) |
MO-AB-07700Y | Mouse Anti-Rabbit CR1 Antibody (MO-AB-07700Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry