Mouse Anti-Rhesus CR1 Antibody (MO-AB-01745W)


Cat: MO-AB-01745W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO01745W
SpecificityThis antibody binds to Rhesus CR1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCR1 (Complement C3b / C4b Receptor 1 (Knops Blood Group)) is a Protein Coding gene. Diseases associated with CR1 include Malaria and Plasmodium Falciparum Malaria. Among its related pathways are Creation of C4 and C2 activators and Primary Focal Segmental Glomerulosclerosis FSGS. Gene Ontology (GO) annotations related to this gene include complement component C3b binding and complement component C4b receptor activity. An important paralog of this gene is CSMD1.
Product OverviewMouse Anti-Rhesus CR1 Antibody is a mouse antibody against CR1. It can be used for CR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesComplement receptor type 1 isoform S; CR1
UniProt IDH9FCQ8
Protein RefseqThe length of the protein is 119 amino acids long.
The sequence is show below: LALPVAWGQCNAPEQLPFARPTELIDESEFSIGTHLKYECRPGYYGRPFSIICLKNSVWTSAEDKCIRKSCRNPRDPVNGMVHVIKDIQFGSQINYSCTEGYRLIGSSSATCIISDNTL.
For Research Use Only | Not For Clinical Use.
Online Inquiry