Mouse Anti-Rat CYP2E1 Antibody (MO-AB-25247H)


Cat: MO-AB-25247H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO25247C
SpecificityThis antibody binds to Rat CYP2E1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP2E1 (Cytochrome P450 Family 2 Subfamily E Member 1) is a protein coding gene. Diseases associated with CYP2E1 include Alcohol Abuse and Fatty Liver Disease. Among its related pathways are Caffeine Pathway, Pharmacokinetics and Acetaminophen Pathway (therapeutic doses), Pharmacokinetics. Gene Ontology (GO) annotations related to this gene include enzyme binding and iron ion binding. An important paralog of this gene is CYP2C9.
Product OverviewThis product is a mouse antibody against CYP2E1. It can be used for CYP2E1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome P450 2E1; CYP2E1
UniProt IDQ71US7
Protein RefseqThe length of the protein is 145 amino acids long.
The sequence is show below: TTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRVPAVRDRLDMPYMDAVVHEIQRFINLVPSNLPHEATRDTVFQGYVIPKGTVVIPTLDSLLYDSHEFPDPEKFKPEHFLNENGKFKYSDYFKAFSAGKRVCVGEGLARMEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry