Mouse Anti-Rat Fcgr2a Antibody (MO-AB-25791H)


Cat: MO-AB-25791H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO25791C
SpecificityThis antibody binds to Rat Fcgr2a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against Fcgr2a. It can be used for Fcgr2a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Fcgr2a; Fcgr2a
UniProt IDM0RCJ0
Protein RefseqThe length of the protein is 187 amino acids long.
The sequence is show below: PPPSLFLFTAFADRQTANLPKAVVKRDPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNQSSTWGQVQASYTFKATVNDSGEYRCRMAHTSLSDPVHLEVISDWLLLQTPQLVFEEGETITLRCHSWKNKQLTKVLLFQNGKPVRYYYQSSNFSIPKANHSHSGNYYCKAYLGRTMHVSKPVTITVQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry