Mouse Anti-Rhesus FCGR2A Antibody (MO-AB-03705W)
Cat: MO-AB-03705W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO03705W |
Specificity | This antibody binds to Rhesus FCGR2A. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. |
Product Overview | Mouse Anti-Rhesus FCGR2A Antibody is a mouse antibody against FCGR2A. It can be used for FCGR2A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Fc Fragment Of IgG Receptor IIa; Fc Fragment Of IgG, Low Affinity IIa, Receptor (CD32); Immunoglobulin G Fc Receptor II; IgG Fc Receptor II-A; Fc-Gamma-RIIa; FcRII-A; FCGR2A1; CDw32; IGFR2; FCG2 |
UniProt ID | F6TRF8 |
Protein Refseq | The length of the protein is 86 amino acids long. The sequence is show below: MLRCHSWKDKPLIKVAFFQNGKSKNFSHMNPNFSIPQANHSHSGDYHCTGNIGYTPYSSKPVTITVQAWAALHRWGSLWLWSLGLL. |
See other products for " Fcgr2a "
MO-AB-25791H | Mouse Anti-Rat Fcgr2a Antibody (MO-AB-25791H) |
MO-AB-25478W | Mouse Anti-Chimpanzee FCGR2A Antibody (MO-AB-25478W) |
CBMOAB-42749FYA | Mouse Anti-Rhesus FCGR2A Antibody (CBMOAB-42749FYA) |
MO-AB-12457R | Mouse Anti-Cattle FCGR2A Antibody (MO-AB-12457R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry