Mouse Anti-Rat Il17a Antibody (MO-AB-26479H)


Cat: MO-AB-26479H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO26479C
SpecificityThis antibody binds to Rat Il17a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Plasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.
Product OverviewThis product is a mouse antibody against Il17a. It can be used for Il17a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterleukin-17A (Similar to Interleukin-17; IL-17; Cytotoxic T lymphocyte-associated antigen 8; CTLA-8); Il17a; LOC301289
UniProt IDG3V7M4
Protein RefseqThe length of the protein is 158 amino acids long.
The sequence is show below: MSPRRIPSMCLMLLLLLNLEATVKAAVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS.
See other products for " IL17A "
MO-AB-34250WMouse Anti-Donkey IL17A Antibody (MO-AB-34250W)
MO-AB-02467YMouse Anti-Chicken IL17A Antibody (MO-AB-02467Y)
MO-AB-57198WMouse Anti-Marmoset IL17A Antibody (MO-AB-57198W)
MO-DKB-00603WRabbit Anti-IL17A Antibody (MO-DKB-00603W)
MO-AB-26646RMouse Anti-Pig IL17A Antibody (MO-AB-26646R)
MO-AB-11813YMouse Anti-O. mykiss IL17A Antibody (MO-AB-11813Y)
MOFY-0722-FY166Rabbit Anti-IL17A Antibody (MOFY-0722-FY166)
MOFY-0622-FY213Rabbit Anti-IL17A Antibody (MOFY-0622-FY213)
MOFY-0622-FY103Rabbit Anti-IL17A Antibody (MOFY-0622-FY103)
MOFY-0622-FY33Mouse Anti-IL17A Antibody (MOFY-0622-FY33)
For Research Use Only | Not For Clinical Use.
Online Inquiry