Mouse Anti-Rat Med15 Antibody (MO-AB-27031H)
Cat: MO-AB-27031H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO27031C |
Specificity | This antibody binds to Rat Med15. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Alternative splicing results in multiple transcript variants. |
Product Overview | This product is a mouse antibody against Med15. It can be used for Med15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Med15 protein; Med15 |
UniProt ID | B2RZ40 |
Protein Refseq | The length of the protein is 84 amino acids long. The sequence is show below: MDVSGQETDWRSAAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSGKSSF. |
See other products for " MED15 "
MO-AB-04365W | Mouse Anti-Rhesus MED15 Antibody (MO-AB-04365W) |
MO-AB-23425H | Mouse Anti-Mallard MED15 Antibody (MO-AB-23425H) |
MO-AB-13909Y | Mouse Anti-Sea-anemone MED15 Antibody (MO-AB-13909Y) |
MO-AB-15513R | Mouse Anti-Cattle MED15 Antibody (MO-AB-15513R) |
MO-AB-35107W | Mouse Anti-Ferret MED15 Antibody (MO-AB-35107W) |
CBMOAB-86426FYA | Mouse Anti-Zebrafish med15 Antibody (CBMOAB-86426FYA) |
MO-AB-15492W | Mouse Anti-Chimpanzee MED15 Antibody (MO-AB-15492W) |
MO-AB-12040Y | Mouse Anti-O. mykiss MED15 Antibody (MO-AB-12040Y) |
CBMOAB-23568FYA | Mouse Anti-D. melanogaster Med15 Antibody (CBMOAB-23568FYA) |
MO-AB-43254W | Mouse Anti-Hamsters MED15 Antibody (MO-AB-43254W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry